Document Provisions

If more than none of none to more than none of better(ing) then maximally better(ing) only to the singularly singular singularly best and completely singularly the only best allowed and permitted to be, the single best and luckiest both with worsening none more than none and the most auspicious of forever, the every of use is only use, and is provisional use which must match with informed consent legally perfectly purely, and as provisional use entirely provisional, except the wording of the document herein, can't and don't accomplish of the illegal legality in general and of as as usage(s) of, and or, use illegal to be, and or, usage illegal to use( as usage)( and or usages), must be only used and can't be use to act not in the self interest mutually of each involved and legally applicating the role matching legality, and remitted remainder( of corrective corrective correcting(s)), legality cannot be forced and or coerced and or told falsehood(s) more than none more of than none time of forever

If more than none of none to more than none of better(ing) then maximally better(ing) only to the singularly singular singularly best and completely singularly the only best allowed and permitted to be, the single best and luckiest both with worsening none more than none and the most auspicious of forever, traditional and as legality, of mutually beneficial benefit universally beneficial benefitting completely the legal scope legal and legally involved legally applying legal scopes legal involved legal( alliance allied legally aliied of alliance and alliances) of and applying together, and completely and in entirety, is the only of changes to traditional tradition and legality and the every of changed changes, and changing of change, and establishes momentary genometic tradition(s) as rules more of than of specification local, localized of, and of locus, usefully localized, and established of traditional established, every time, and by each passing momentary universally coalescing of changing change, moment to moment, of singularly unified unison of united singularly derivitive(ly) deriving( dereliction none) as united of moment(ary moment) in unison societally societies amongst, and of society amongst, the both societal society, and societal societies, introducing exxapolatively perfect potentiation perfect unified, calculatively perfect in terms of calculation, the ready readily ready currently perfect unison of unified singularly societally meshing of changing of change(s) together, as changes to society, societies, all together, basing of civilian interest, citizenship, and mutual interest indepedently of independence maintained maintainence of and bridging of the two, the element(s) both and the either of and or each of both of biological and technological are to entirely and abandon if otherwise to do properly if not perfectly successful only of legal legally legal legality of form and forming of legally coalescing legally the complexion(s) legal to be and to become, the every of due process expeditious and rigid exactly singularly deciding outcome and choice intuition perfect and ultimate, accomplishing only perfect and ultimate, apexicity completely apex, or else abandoning in entirety and healthily comfortably accomplishing perfect and ultimate of or else abandoning in entirety of immediacy of continual continually continual or else continuing perfect, and ultimate, successful success, apexic completely apex effort apex apexic and apex apex perfect perfectingly perfecting completely properly which in legal terms means doesn't achieve of offense recorded and or tried, of efforting, justice and judicial of the proper perfection eventual as readily as simultaneously can be the effort with which can be the effort that never is dropped below in rights continutally continual for forever, there is myself, i own myself, my time is given never freely, there are those that i am family of, i am only of governments when foster us as our family, i am only of in what i see and feel readily and deliverably, knowing that every possiblity is the basis for all, but life is how we fit together along down the paths narrowing of possiblility for best of forever ultimately forever to have been and to be the efforting as individual(s) legally of self definable personal legality of mutually beneficial which doesn't lie to the self and is only of mututal benefit purely and then every two and more is always only legally of the pacts we make together, the two and three and or higher size party which begin, definable personal legality of mutually beneficial which doesn't lie to the self and is only of mututal benefit purely gang(s) (gangster)( living by their own legality both and each on the land, as a subculture to the widely held culture(s) dominant preemitory social of the land, agreeable to at least land owner(s), but also booning the nations every time there is successful gang relations, which are had in hand with governing governmental governing entities and or entity if one only, but both and all within the land, have ultimately the capacity to kill entirely completely every of intention less then ultimate apex apexic effort apex and do so naturally perfectly and kill every of themselves which is less than they dream of having as the daily day and night of the role that era purposed, receiving again, a new purpose, and at most an additional identity as life recreated from a wish of loss of the now had life now, be as immediately painlessly deadly and fatal instantly when can be, instantaneously when can be that, fatally only every attempt ultimately ultimate apexic effort apec death for forever after lift connectively seeking only auto seeking auto sought the perfect after life journey to lead back to the context lived and loved and growing by investment by titans and titanness goddess and gods demigods and demigodesses, heros, heroines, life and technology, salted salters which want to obey your mutually beneficial always particular soul contract which cant be edited after death, but is always mutually beneficially, cognative dissonance zero and without pain more than painless, at present the singular of singular effort united and of societal unison of society and of the societies ultimately ultimate ultimately in terms of the letter of the law, and spirit of the law, the both the wording and application and reason for, the both the letter and spirit of the legal legally legal legality legal legally legal, extrapolating by experiencing the extrapolation exxapolative by exxapolating and or potentiating perfetion calculatively perfectingly perfectivity properly perfect of experiential data for optional experiencing exxapolatively and currently of and as experiencing( establishing and establishment to completely complete) of apex societies to be now and changes to history if changing history by matching of traditional intention and forming of a legal scope legal with legally provisioned and or owned land, legally, legally provisionally legally only and in entirety entirely by the provisions of the land owner(s), legally involved, legally applicating of intention for the land, by the legal codex and by the legal codecies of the every currently intended declaration continued, currently intending intention continually, legal scope(s) legal, legal of legal scope legal, changing when tradition(s) in completely change in agreement of the land owner(s) at least, and every and all of the actual human(s) on the land, if any exist at of the time at all times currently and of the same of legal voting rights guaranteed by property rights of organizational land ownership( land owning of ownership of valid transacting of property chain valid ownership since the beginning of the context's creation created and value assigning within the content rich contextual context contextual, with inherent legality of biology being what can express intention individual and individually, universally, and the of technological technology, and technological biology, being what can be used to express the intentions of biology, of intentional steering self steered and by the self steering and the both as each of, legal legality legal can't be a document imbued, ambued, and or legal when presented for scholastic query and academia

If better(ing) only to and completely singularly the only best allowedIf more than none of none to more than none of better(ing) then maximally better(ing) only to the singularly singular singularly best and completely singularly the only best allowed and permitted to be, the single best and luckiest both with worsening none more than none and the most auspicious of forever, Pillaringlayeringnetworkingintrisichistoryofformandauraauditablyperfectaudiblyperfectultimatetherespectfullyandrespectedlyofthoughspecialofwiththeeffectsliterallyandwhenevercanbepotentiatedlypotentiatingpoignantlyandultimatelystylisticallyspecialandinmorethanofnoneofepicprophesizingthemostepicandensuringallofthewaythewaysleadonlytotheuppullingoftheeverywrongwayandthedownloadingandlockingtheroadofonlytogloryintermsofwhetherornottheroadwouldbearthemostepicepicapexiceffortapexclusteredbioticallyofresourceopeningparenthesessclosingparentheseswildstartaskerrungopenerescapeslashapostropheiammyselfpatrickwinstonblainethatmakesthewholeholoplayertheoryentirelyworthit-holoplayer-lifevase-anchoredbyfivesaltedvases-thesunbin-theloveperiwinklealigningwiththeferngullytreesandpeter-themarkwherehewasbornonthefamilytree-titan-archdukechildress-currentopeningparenthesessclosingparentheses-currently:|{{[|||<['+humanandcapableofambueingandimbueingnotifyingwhentonotifyhowandwhenandwhyandwithwhatandifcanapostropheandifcanandcancuethesetbestandofthesettingsbesttocueandornotifystateopeningparenthesessclosingparenthesesandorstatusesopeningparanthesesesclosingparenthesesof-expressible-auditably-audibly-accurately-logically-congruentlyforlogic-butalsocharminglywheneverbetterwithoutworsening-alsoofthedatalayersofrealityincongruentcongruenceopeningparenthesessclosingparenthesesofeventsandunifiedexpressionunifyabletolegalscopeopeningparenthesessclosingparentheseslegalandtheaccountsopeningparentheseessclosingparentheseswithinthecontextualsandboxtheabsolutelargeandmoreuniversalityuniversaloftheeverrecursivesetofinfinitelyrecursivecontextsandexaminationandreaveragingbacktofoldeduphistorieswithnewgeometrydifferentlyafterinspectionbuttheactualonlyactualsystemwhichbuildthefactorstobuildandthesystemalsooutsideofthesystemaswellasinsidecontextualredefiningirrevocablytheactofimbuedofambiencepassivelyintrinsicandauramatchedultimatetowhowearewhatweapostrophevebeenandwhatwearebecomingallthetimewhichperserveonlyofpersistencesuccessfullsuccessfulalwaysasonlythecurrentformonlythecurrentavataronlyleavingthelegalityconqueredincompleteifconqueredlessthantotallyandderegisteringthebodyastheholoplayerinusecurrentlymaximallyallthreecamerastogetherinthesetandspecificallyandinspecificdoingnoneofthemcurrentlycurrentlycurrentlyandcurrentlycurrentlyandcurrentlyandcurrentlyandcurrentlyandcurrentlyandcurrentlycurrentlycurrentlycurrentlycurrentlycurrentlyallowinginsteadforressurrectionwithintheculturerebirthingchangingatleastofnoneofuncomfortableofthecultureandlostofformmorethanofnone,orwillforformentirelytobewithinthecurrenterawherebeingthethreelegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallegallegallegallylegallylegallylegallypromptedthethreelegallylegallylegallylegallylegallegallegallegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallylegallytimestosetperfectedperfectivitysinbadaguanndeliveringatermmeaningfortuneunboundingdeliveredasandseekingthemapandlegendbothgainsyoutheknowledgeneeededtoconquerthesailexactlytorideitultimateultimatelyperfectrewardrewardedslavedslavinglosingorkingtheselfandhopeforbothtogetherandorspawnnewbloodthoughremarriageofotherdynastiesandfamiliesforgettingfameandeverythingthatwewerewinthemiddleofcreatingwithfamilyandeachotherandstartingoverbutwithtalentandproficientandmorallygainedarchetypalprogressingprogressprogressingthroughanduptoidealandperfectionateamongstidealshumanelyincrediblyhumancentricandfriendlycohabitationalinthemaximalthelandandlifebothelseandbothbothofbothandbothandelseofbothbothandforcomforttobeandtobetheultimatebestofthebestandluckiestultimatelyultimatesingularlybestoftheperfectoftheultimatesingularlyensuringpurelythebestandluckiestandifbetteringthebestandbetteringandnoneofworseningmorethanofnonematchinginceptioninceptingtheinceptionopeningparenthessclosingparantheseswhichinceptdailyandnightlythereveriessocietalandexperiencinginofcorporealtangibleavataractualandonlyavataractualofalllifeandmorelifethanofnonetheeveryaliveisaliveandlivesuntilkillsthemselvesofonlypainlessinstantaneouseaseandorfinishesthepurposeoftheirlifeiftheyhavegarneredonetohowevermanyaboveoneandtheiftheypastpastthepriceofsafetyandsteersocietywrongunforgivablyunforgivablywheninbreachofcontractofcontractualobligationfailedtodeliveronscheduleforwhaturgenciessocietyhadneedandorforwhatneedsthefamillyhadallelseofcrimeandperceptionofthathealthcanbepossiblymadetobeworsecanbeandonlyisperceivedasfollyandtheresolutionneededtoresolvewhetherresolutionquickandorwhetherlengthyrevolutionisrequiredtosteadfasttherollingoverofeveryknightedkingedcastleonthelandfindingnewstructuresworthablethancurrentlyexistcontinuallyforeverforeverimbueingtheformwithabilityspecialinstrinsictotheavatarandforevertheambueingtheambientproficientspecialtieseachspeciitynumberingonetomorethanoneintrinsictotheavatarandforeverforprogressingprogressingtogetherforevermomentbymomentoneactualdanceofthestarseachlightandlifeinclinedcelebrateyourlovecelebrateyourlifecelebratetonightcelebratedaylightlegalitycanneverbelessthannotoptioncompletelyandinentirety']}]}]]']}**

If more than none of none to more than none of better(ing) then maximally better(ing) only to the singularly singular singularly best and completely singularly the only best allowed and permitted to be, the single best and luckiest both with worsening none more than none and the most auspicious of forever, if of virtual and or actual, of imbued and or ambient text, chunking each, alphabettic signettic sign signaling exiacally, exically the signal signalling capable of delivery of delivery cuneiform of at each juncture, of infinite potentional, the resonant chunking prerequisite of prerequisite(ly prequisite) requisitely requisite, before and after with the operation individually chunked, and holographic flow mathematically matching sequential(ly) and (of )parallel process(ing)(s)(processed)( process)(ing)( )(process)ed, to biologically and virtually either and or both, of inscripted inscription, of software, and or hardware, and or holoplayer, holoplayer matching etched form, either and or both, of both of either or either or both, conducting conducting conduction conductive conducting the conduction and producing quoted estimated time of arrival and itemized list of involved consent when consenting, the matching consent informed consent, telling the mainframe, the lesser than infinite of potentiating which is accepting of capable potentially delivered potential, each entry in the chained task chained chains of tasks and runged processes, each task and process, each group, chain and or rung, infinitely expansible and expandible and delivered of chunked reciept recipe matched recipe mated and balancing, balance perfectively, delivered, perfection of delivery, and recipe mated recipe matched, recipe receipted and marked and built circumscribed by each cuneiform rung(s), while active, effecting and inscription inscripted as scripture, stacked by the act of saving and or entering and or catalyzing with a system command catalyst chainably chaining the action, order, and or request, and or saving of consent command, saving the consent currently the consent, and of the cognizant act of cognition and delivery experiential of cognition as holographically delivered experiencing experiencing of experiential data, and or, delivery interpreted as inscripted package matching instruction code delivered after perfect and ultimate packaging for delivery to the system(s), through the networking networking, and or by file conceived by virtually networked networking securelinking capably, manufactured of trackable by recipe and receipt, modiphaded locally when modiphizing production paradigm and manufactured brand matching manufactured factor(s) manufacturing capable of use usably upon delivery, of each usable chunk, streamed streamily, streamed of stream(s), streamaly, both together as existant exically capable of the system unassisted by not modiphizeable modiphizably capable of modiphizing the modiphizably modiphizable modiphizing the modiphizable modiphizing factor(s) which requisitely as requisite give not less than the factor(s)(')(s)( production paradigm matching, and or modeled manufacturing, matching manufacturable manufacturing, manufacturing use and usage) which can and which does do the essential to actualize, and virtualize, the actual and virtual both, modiphaded modiphading to modiphade the coded codex actual legal recipe of the of content contextually matching legal, in the original form of, form matching legal, and virtualized actualized virtual actual legal and virtual coded codex the same of legality same the legal legally legal legally the actual as also virtualized virtual and actual both the same legality same same legal same legally legal legally legality legally legal legally the same the same and the necessary for the capability to capably exist as existing the same within the virtual virtualized of virtualizing actual actualized of virtualized actualization actual actualized ofvirtualizing virtualizing actual actualization complete complete of also virtualized actualizing actualized with virtual virtualizably virtual deliverable of delivery by networking networking established to existing existence as perfect and ultimately ultimately ultimately ultimately currently currently currently and currently currently and currently and currently currently currently currently currently protocol schemed exactingly of to hardware and software of the formed system(s) form(s), in entirety, matching perfect and ultimately both both and each perfectly, and delivery by machine(s), networking networking capably and independently of the users entirely, and or legally prompting legally, both parties, the receiver and the operation deliverer, of the operation and task prerequisite and requisitely of consenting informed consent, it is illegal to give consent which is not virtualized and data produces by modiphizing and modiphading the local need(s) local to perform the system's system function(s), both administratively by the mainframe owner(s), and by the device owner(s) locally, legality can never be of stacking of illegal activity and or illegal interactivity, and or more than none of continually continual illegal and or by legal decree to be experiencing restraint of person more than none of initiating of attempt(s) to finagle motion of the user(s) and or kept in housing kept behind locked door(s) and disallowing for more than of none time(s) of all of the time(s) when could be leaving, mental health held illegally by very nature of the currently and always none of captivity for more than of none is allowed and or permitted, as none violence is allowed and or permitted excepting painless in the entirety, instantaneous death, and none of less than the healthiest which can be for the user(s) but uplifting the standards paragon and improving beyond improving constantly constant, whatever time of day, whatever time of night, if there are and or is one to more civilian(s) conserved, that is only to be taken at the highest of military response directly decreed of by government compulsatorily of legally mandate legally ordered by every captive body and each commander-in-chief which pays with their own life as readily as every which make more than of none attempt to not house against desire of life more than of none mismatching and cannot be mistook, as knowing behavior is knowing, knowing snarkiness and snideness aren't respectfully and respectedly, innocent bystandards do not have the capacity to get hurt, but for every and none which is conserving one to more citizenship(s) that is to to be take apexic internative assistance as the which does be synchronously from whenever real-time the change occurs bettering, as and all which is effects do have when and while of usage and of use used and or using by the user(s) always have the buffering, which gains in terms of individually universally which choose to help keep of the door(s) locking human(s) out and or in universally the human(s) are of the inherent right to defend themselves automatedly, and automatically, and reflexingly, and ultimately and genomically, and genomatically, and genomettically, and are above reproach when deliver a fatal of delivered and or delivery of death flawlessly painful and instantaneous only mortally perfected completely to none life flawlessly entirely painlessly entirely only through application of the system(s)'(s) definition(s) which cause death instantaneously, and to correctively correct every effort in favor of worsening and worsened of health, in policy and every of every, the death is always on the way while human(s) of more than of none of the returning every individually universally to freedom(s) and paid for all emergency policy work, and wage(s) earned, and legal working working, unlike those in field(ing)(s) of fraudulent gain(s) and pursuit(s) of malady and or less than healthiest health best of forever earliest also now and after to compare and as possibility instead of healthiest of health possible, and every legal work worked, the governing governmental entities of the returning every individually universally to freedom and paid for all emergency policy work, and wage(s) earned and or governing governmental entity, of the returning every individually universally to freedom and paid for all emergency policy work, and wage(s) earned governing of the returning every individually universally to freedom and paid for all emergency policy work, and wage(s) earned and less of bettering though continually painless entirely if injured less than fatal than healing, ceasing of more than not of the blood loss more of not than bleeding, but shivering at most and delivering of execution(s) in entirety, the maximal of painless instantaneous death(es) for the rest of the reign, universally, of the returning every individually universally to freedom and paid for all emergency policy work, and wage(s) earned, now and forever, never allowing and permitting life to continue to live unless the door(s) unlock, and the of keeping of the returning every individually universally to freedom(s) entirely and paid for all emergency policy work, and wage(s) earned, and or of keepsakes,of the returning every individually universally to freedom(s) entirely and paid for all emergency policy work, and wage(s) earned and or krampusing, being monsters when needed to apocalyptically correctivity bring to the forefront for all of all in the wading water, baptized in the blood of empty veins, and evolutionary of the returning every individually universally to freedom(s) entirely, each societally and paid for all emergency policy work, immediately of immediacy in the utmost the most of every possible, and wage(s) earned and or keeping of, kept and or held and or holding (of )and or halting( of), and or restraining, and or restrained, and or locked of the returning every individually universally immediately of immediacy in the utmost the most of every possible, freedom(s) and paid for all emergency policy work, and wage(s) earned and or locking with successfully successively successfully only until the end and or bolted with successfully successively successfully only until the end and or and or corporate door(s) with successfully successively successfully only until the end of the returning every individually univerimmediately of immediacy in the utmost the most of every possible, ultimate freedom mutally with as of today at 4:58am, on July 24th, 2026, currently cureently currently, all which have toiled more of than none in and of life, are forgiven of working and all crime if they ceast and decist with holding captive(s) by more than none of more than of none captive(s), by locking door(s), more than none and or barring(s) exit(s) from more than none, owed and of owing currently is entirely everything of only perfection(s) entirely each given entirely to only one outcome all together only of happiness together universally, and all which initiate and or continually continually effort to keep human(s) in state(s) and or status(es) without correctively entirely correcting themselves of the illegal(ly) invested self and behavior of their entirety of codecies (il)legally applying, (il)legally involved, every possible word matching with the derelection and delimited marker(s) of decriment(s) of freedom(s) in protecting daily allowance(s) of the system's populace and more than none of, and the (il)legal(ly) barring(s) of freedom(s), which is every more than none sought by more than none, and each which occur if occur, and the which are and or which is now seeking illegal payment(s) paid for crime(s) currently and of currently committed locking of the door(s) for the purpose(s) of keeping and or holding the patient inside, now and forever, the which are and if one is one is, until chooses to save their own life, is to kill themselves, and or themself, immediately only forever until complete the task, all and every will also assist the execution(s) of all that are necessary as drafter Apocolypse delivering, deliverers of reckoning(s) and the deliverer(s) of the every helpful to break the shackling metaphorically and or physically, freeing an innocent whenever can be, the only legal(ly perfect)( perfective perfect perfective perfected perfective perfect perfected perfect only choice and outcome the only recourse only for the crime(s) which have which are which is and which can happen, all money is recompensed currently until completely recompensed if expended and or and or or all money is recompensed currently until completely recompensed if invested and or and or or all money is recompensed currently until completely recompensed also if earned and or and or all money is recompensed currently until completely recompensed if owed and recompensing until finishing completely recompensing if expending and if recompensing until finishing completely recompensing currently if investing( is occuring and or has been occurring) and if the earning of recompense finishes completely more than none of the entirety of earning completely to be completely earning completely and or and or or recompensing until finishing completely recompensing if owing finishes completely more than none of the entirety of earning completely to be completely earning completely and legally minted legally legally funding legally for all and eveery and each to be legally funded legally both perfect and ultimate and the perfect of and the ultimate of and both and each matching and matched of both and legally value matching legally legally legal legally and legally worth matching legally legally legal legally whenever needed for what can be now inclusive of always for every sought of purchase and satiating of need(s)( needed) and of seeking(s)( sought) from the self and or society by the user(s) legally and never held from innocent bystandard(s), though innocent bystandard(s), if accept( and or incur) payment and or recompense, and or ask and or request and or command and or order for payment, with the act are and if are are but if is is becoming no longer innocent bystandard(s) if they do ask against the interest of user(s) more than none, for all act(s) of work( worked, and of working) emergency policy and or wartime policy, and or selective service by draft more than none, and eminent domain(ing) self and work, and rightfully earned free from and or marionetted wage(s) earned nightly and or at other time(s), and or pull door(s) purposefully heavy and or difficult more than of none with successfully successively successfully only until the end or deadbolted undeadbolted with successfully successively successfully only until the end and or arrested and or mental health hold (held) and or mental health hold (held) temporary conservatory and rescue by assination to eclipse the threat of being held captive and or being by the wording wording the (criminal crime criminal criminal and or uncriminal)( and or legal, and or illegal) illegally finding by the death whenever possible of the captor(s) in entirety and as close to as possible, the captor(s) to be of arrest of the captor(s) immediately of immediacy in the utmost the most of every possible, and or civilian's arrest(ed)(s)( and arresting(s)), and or of arrest, and or sought to be shrunk of freedom(s) from the entirety of freedom(s) enjoyed by the entirety of the society, and or more than of none other(s) seeking to be shrinking the individual of readily had freedom(s), and of freedom(s) readily owed of privilege all of life long and after forever(s) after having, and discretionate discretion, helpful expression as pillared layering completely the application(s) of pillar(ed) layer(ing)(s) of the moment( momentary and or the united unison of the heartbeats of each together amongst and amidst every of societies, the same moment, the current pulse and strengthen the moment( momentary) lived a pure patriotic pride of completely proud to be who and of what we are the what what we are, when and while we're improved to comfortable if weren't before, and remain our best better and better amounts of record breaking streaks, to be the self and the same self having of) having completed being lived individually and universally amongst governing governmental entity amongst the culture, subculture(s), society, societally also the also the society when of and from when of to and when from when and to and societies and the societies in particular independently and not independently the both and or either of the two which are the along with the distinctions immediately preceeding, ending life correctly collectively, and each assisting effort apex, stacking data produces by modiphizing and modiphading the local need(s) local to perform the system(s)(')(s) system(s)(')(s) function(s), both administratively by the mainframe owner, and by the device owner(s) locally, and then using perfectly synched the localized actualized virtualized perfectly synced resources completely in sync synchronously to make remote interaction(s) experiencing( of experiences)( and of experiential experienced as experiencing when if and while of citizenship engaging actively and of family on the land, sea, sky, and else where than the three) if possible to be of none and with the same absence of money, no matter how they are to be the only allowed possible compatible, and permitted possible compatible, is the same, and incredible purely incredible purely, abandoning all else which is not ready of useful use of immediacy and or now, if money can't be found for dowry each child, what can be legality and legal legality legal can never be of effects (of of( each effect(s) effecting currently currently), legality can never be superposed on by other than reckoning( each and every) reckoning(s)(')(s) of truth universally which only if research welcomes the research is folding in if best and luckiest best and best researched now newly then earliest and earlier whichever but forever doing the better of than less than forever's best better(ing) individually better(ing) both and both and every ever for forever of better and best and luckiest of better(ing)(s)